DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG9372

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:265 Identity:87/265 - (32%)
Similarity:129/265 - (48%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EELKCGYGNPDAVKVQF-NVTEGQ-AKPAEFPWTIAVIHNRSLVG------GGSLITPDIVLTAA 83
            |:..||     ....|| .:|.|: |:|.|:||..|::..    |      ||.|||...|||||
  Fly   160 EQRGCG-----ITSRQFPRLTGGRPAEPDEWPWMAALLQE----GLPFVWCGGVLITDRHVLTAA 215

  Fly    84 HRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTY 148
            |.|:.|:.|||.|..||:. ...|.:....:..:..||:|..:|.|...|::|::.:||......
  Fly   216 HCIYKKNKEDIFVRLGEYN-THMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNT 279

  Fly   149 KINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYT 213
            .|..:|:|......|....||.|||..:|...| ..:|.:::||:..:..|:....:       .
  Fly   280 YIWPVCMPPVNEDWSDRNAIVTGWGTQKFGGPH-SNILMEVNLPVWKQSDCRSSFVQ-------H 336

  Fly   214 LPRGLICAG-GEKDNDACTGDGGGALFCPMTEDPKQ-FEQIGIVNWGVGCKEKNVPATYTDVFEF 276
            :|...:||| .|...|:|.||.||.|   :.:.|.| :..||||:|||||.::..|..||.|..:
  Fly   337 VPDTAMCAGFPEGGQDSCQGDSGGPL---LVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRY 398

  Fly   277 KPWIV 281
            ..||:
  Fly   399 LDWIL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 80/240 (33%)
Tryp_SPc 50..280 CDD:214473 78/237 (33%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 80/244 (33%)
Tryp_SPc 176..402 CDD:238113 79/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.