DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG4998

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:269 Identity:96/269 - (35%)
Similarity:148/269 - (55%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KCGYGNPDAVKVQFN---VTEGQAKPAEFPWTIAVIH---NRSLVG-GGSLITPDIVLTAAHRIF 87
            :||..|...:..:..   ..:|.::..|:||.:|::.   ..|:.. ||:||....:::|||.|.
  Fly   920 RCGVRNAAGITGRIKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIK 984

  Fly    88 NKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDR--EFPLTYKI 150
            :::..|:.|..|||:....:|.:|:.|..|:.:.||..:......|:||:|.||:  :|.....|
  Fly   985 SQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPVDFTKNPHI 1049

  Fly   151 NTICLPTQKRSLSSTRCIVAGWGKYQFSDTH--YGGVLKKIDLPIVPRHICQDQLRKTRLGQNYT 213
            :..|||.:....:..||...||||..|.: |  |..:||::|:||:....|:.|||.||||.:|.
  Fly  1050 SPACLPDKYSDFTGARCWTTGWGKDAFGE-HGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYK 1113

  Fly   214 LPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKP 278
            |..|.:|||||:..|||.|||||.|.|   :.......:|:|:||:||.:.|||..|..|..:.|
  Fly  1114 LNPGFVCAGGEEGKDACKGDGGGPLVC---DRNGAMHVVGVVSWGIGCGQVNVPGVYVKVSAYLP 1175

  Fly   279 WIVQQIKEN 287
            || |||.::
  Fly  1176 WI-QQITQS 1183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 89/240 (37%)
Tryp_SPc 50..280 CDD:214473 87/237 (37%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 90/242 (37%)
Tryp_SPc 942..1177 CDD:214473 87/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.