DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG4613

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:270 Identity:74/270 - (27%)
Similarity:120/270 - (44%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIV 95
            |..|.|:..::   |...|.:..::||...:|....|..||:||....||||||.:...|:..:.
  Fly   127 CTCGVPNVNRI---VGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVS 188

  Fly    96 VSAGEWEYGS----ALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLP 156
            |...:.:..|    ......|..|       |..::.....:::|||.||:..||...:...|||
  Fly   189 VRLLQLDRSSTHLGVTRSVAFAHA-------HVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP 246

  Fly   157 TQ-KRSLSSTRCIVAGWGKYQFSDTHYGG----VLKKIDLPIVPRHICQDQLRKTRLGQNYTLPR 216
            :. .::....:.||||||..|     .||    ||:::.:||:....|:....::.:...     
  Fly   247 SNWLQNFDFQKAIVAGWGLSQ-----EGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDT----- 301

  Fly   217 GLICAGGEK--DNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPW 279
             ::|||..|  ..|||.||.||    |:....:.|...|:|::|.||.:.:.|..||.|..:..|
  Fly   302 -MMCAGYVKTGGRDACQGDSGG----PLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEW 361

  Fly   280 IVQQIKENLY 289
            |....:::.|
  Fly   362 IAVNTRDSCY 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 68/243 (28%)
Tryp_SPc 50..280 CDD:214473 66/240 (28%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 68/250 (27%)
Tryp_SPc 137..362 CDD:238113 68/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.