DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG4477

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:307 Identity:72/307 - (23%)
Similarity:118/307 - (38%) Gaps:68/307 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVALFVL--GVAENVEN----LQQIEELKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNR 65
            |:::.|.|  .:.::..|    |.:::.|..|..:.|::.:.......:::.||           
  Fly    10 LVISFFPLYNCLGDSPRNAFSSLNRVKRLSDGDFDEDSIALSNYCVSLRSRSAE----------- 63

  Fly    66 SLVG-----GGSLITPDIVLTAAHRIFNK-----DVEDIVVSAGEWEYGSALE--KYPFEEAFVL 118
            ...|     .|.::.|..|:|:||.:.||     ....:::.||      .|.  ||.....||.
  Fly    64 KFFGDNHFCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAG------TLNRLKYIPNRTFVT 122

  Fly   119 KMV---IHKSFNYQRGANNLALLFLDREFPLTYK-INTICLPTQKRSLSSTRCIVAGWGKYQFSD 179
            .:.   :..||. .|...:..||.:...||...: |:...||... .|...:|.|.|||:     
  Fly   123 PVTHIWLPDSFT-MRNKQDFGLLKVKNPFPRNNEHISIARLPVHP-PLPGLKCKVMGWGR----- 180

  Fly   180 THYGGVLKK----IDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDA---CTGDGGGA 237
            .:.||.|..    ||:.::....|...||...:..        :||....|..|   |.||.|  
  Fly   181 MYKGGPLASYMLYIDVQVIDSEACAKWLRVPSVEH--------VCAVDSDDLTAQQPCGGDWG-- 235

  Fly   238 LFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284
              .||..:...:   |||....||...::|:.||:|.....||.::|
  Fly   236 --APMLHNGTVY---GIVTILAGCGVSHLPSLYTNVHSNANWIHEKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 63/255 (25%)
Tryp_SPc 50..280 CDD:214473 61/252 (24%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 63/259 (24%)
Tryp_SPc 55..273 CDD:214473 61/256 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.