DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG18477

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:260 Identity:108/260 - (41%)
Similarity:151/260 - (58%) Gaps:4/260 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QQIEELKCGYGNPDAVKVQFNVTE-GQAKPAEFPWTIAVIHNR--SLVGGGSLITPDIVLTAAHR 85
            :.|.:.:||:.|...|...|...: |.|:.||.||.:|::..|  |.|.||:||.|.:|:||..|
  Fly    86 EPITDPQCGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQR 150

  Fly    86 IFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKI 150
            ..|.....:||.||||::.:..|:.|..:..:..:|.|..||.:.||||:||:||.|....:..|
  Fly   151 TENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHI 215

  Fly   151 NTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLP 215
            |.||:|:..::...:|||..||||..|.|..|..|||||.||:|.|..|:.||| ...|.::.|.
  Fly   216 NPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLR-LYYGNDFELD 279

  Fly   216 RGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
            ..|:|||||...|:|.||||..|.|.:.::|:::|..||||:||.|....|||.||:|.....||
  Fly   280 NSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344

  Fly   281  280
              Fly   345  344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 101/233 (43%)
Tryp_SPc 50..280 CDD:214473 99/231 (43%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 99/231 (43%)
Tryp_SPc 113..344 CDD:238113 99/231 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471536
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.