DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:266 Identity:92/266 - (34%)
Similarity:131/266 - (49%) Gaps:20/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LKCGYGNPDAVKVQFNVTEG-QAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAH---RIFNK 89
            |:||..|| ....|..:..| .|.|.||||...:..:.....||||||...:|||||   |:.:.
  Fly   385 LQCGNKNP-VTPDQERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSW 448

  Fly    90 DVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTIC 154
            ||..:....|::..|:..|....... :.::|.||.|.:....|::|:|.|....|.|.:|..||
  Fly   449 DVAALTAHLGDYNIGTDFEVQHVSRR-IKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPIC 512

  Fly   155 LPT----QKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLP 215
            |||    |.||.|.....|||||..: .:.....:|:|:|:||.....|..:..:...|   .:.
  Fly   513 LPTSPSQQSRSYSGQVATVAGWGSLR-ENGPQPSILQKVDIPIWTNAECARKYGRAAPG---GII 573

  Fly   216 RGLICAGGEKDNDACTGDGGGALFCPMT-EDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPW 279
            ..:||| |:...|:|:||.||    ||. .|..::.|:|||:||:||.:...|..||.|....||
  Fly   574 ESMICA-GQAAKDSCSGDSGG----PMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPW 633

  Fly   280 IVQQIK 285
            |.:.||
  Fly   634 IYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 83/240 (35%)
Tryp_SPc 50..280 CDD:214473 81/237 (34%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 82/244 (34%)
Tryp_SPc 400..637 CDD:238113 84/246 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.