DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and PRSS48

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:294 Identity:88/294 - (29%)
Similarity:138/294 - (46%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLGVAENVENLQQIEELKCG---YGNPDAVKVQFNVTEGQ-AKPAEFPWTIAVIHNRSLVGGGSL 73
            :||...::.:|    .|.||   |.:        .|..|| |....:||.:::..:.:.:.||||
Human    28 LLGFHISLSSL----SLVCGQPVYSS--------RVVGGQDAAAGRWPWQVSLHFDHNFICGGSL 80

  Fly    74 ITPDIVLTAAHRI------FNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGA 132
            ::..::|||||.|      |:     ..|..|....|.:.::..:   :|.|:|||.  .||...
Human    81 VSERLILTAAHCIQPTWTTFS-----YTVWLGSITVGDSRKRVKY---YVSKIVIHP--KYQDTT 135

  Fly   133 NNLALLFLDREFPLTYKINTICLPTQKRSLS-STRCIVAGWGKY-QFSDTHYGGVLKKIDLPIVP 195
            .::|||.|..:...|..|..||||:..:.|: ...|.|.||||. :.||..|...|::.::||:.
Human   136 ADVALLKLSSQVTFTSAILPICLPSVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIID 200

  Fly   196 RHICQDQLRKTRLGQNYTLPRGL-------------ICAGGEKD-NDACTGDGGGALFCPMTEDP 246
            |..|:         |.|. |.|:             ||||..:: .|:|.||.||.|.|.:   .
Human   201 RQACE---------QLYN-PIGIFLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHI---D 252

  Fly   247 KQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
            ..:.|.|:|:||:.| .|::|..||:|..::.||
Human   253 GVWIQTGVVSWGLEC-GKSLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 78/253 (31%)
Tryp_SPc 50..280 CDD:214473 76/251 (30%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 79/258 (31%)
Tryp_SPc 51..288 CDD:238113 81/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.