DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG5390

DIOPT Version :10

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_609374.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:274 Identity:111/274 - (40%)
Similarity:155/274 - (56%) Gaps:15/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGYGNPDAVKVQFNVT---EGQAKPAEFPWTIAVIHNRSLVG----GGSLITPDIVLTAAHRIFN 88
            |||.||:.  |.|.:|   ..:|:..||||.:|::.....:.    ||:||.|::||||||.:.|
  Fly   135 CGYQNPNG--VGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHN 197

  Fly    89 KDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTI 153
            |....|||.||||:..:..|....|:.:|.:::.|:.||.....|::|::.|:..|.|...|.|:
  Fly   198 KQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTV 262

  Fly   154 CLPTQKRSLSSTRCIVAGWGKYQF-SDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRG 217
            |||.........||...||||.:| .|..|..:|||:|:|:||...|:..||:||||:::.|...
  Fly   263 CLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDS 327

  Fly   218 LICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI-- 280
            .||||||||.|.|.||||..|.||:.....:|:..|||.||:||.|.|:|..|..|.:.:|||  
  Fly   328 FICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWIDA 392

  Fly   281 ---VQQIKENLYTP 291
               :..|....|||
  Fly   393 KLKIWSIDPRHYTP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..280 CDD:214473 97/234 (41%)
CG5390NP_609374.1 CLIP_1 64..115 CDD:465709
Tryp_SPc 153..390 CDD:214473 97/236 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.