DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG3117

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:286 Identity:123/286 - (43%)
Similarity:172/286 - (60%) Gaps:12/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLGVAE-----NVENLQQIEELKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGGGS 72
            |:|:::     :|:.|     |:..|  |:|:.....|...|.||.:|||..|:....|.:||||
  Fly    63 VIGMSKSPPQHSVDTL-----LRTSY--PNALDGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGS 120

  Fly    73 LITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLAL 137
            ||||.:||||||.:......||:|.||||:..|:.:..|..:..|:|::.|::|||..|||:|||
  Fly   121 LITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNYSSGANDLAL 185

  Fly   138 LFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQ 202
            ||||..|.|...|.||.||...::.....|.|||||....:|.....:.:|:|||:|....||.|
  Fly   186 LFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQ 250

  Fly   203 LRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVP 267
            ||.|::|.||.||..|:|||||:..|.|:..||.||||.:.:||.::||.|||::||||.:.|||
  Fly   251 LRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVP 315

  Fly   268 ATYTDVFEFKPWIVQQIKENLYTPDN 293
            .|:|.|.:|..||...:::.|..|.|
  Fly   316 TTFTHVSKFMEWINPHLEQVLSVPGN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 110/232 (47%)
Tryp_SPc 50..280 CDD:214473 108/229 (47%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 110/233 (47%)
Tryp_SPc 95..328 CDD:214473 109/232 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471509
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.