DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG9673

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:120/292 - (41%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVIHNRSLVGG 70
            ||.:.|.:.|:..:.|...|...|    |..|       |.:|     |:||:.:|.:|::.|..
  Fly     7 TLGLGLLIFGLILSAEASPQGRIL----GGED-------VAQG-----EYPWSASVRYNKAHVCS 55

  Fly    71 GSLITPDIVLTAAHRIFN-----KDVEDIVVSAG---EWEYGSALEKYPFEEAFVLKMVIHKSFN 127
            |::|:.:.:|||||.:.:     .|...:.|..|   ::..||.:.        |..::||.|  
  Fly    56 GAIISTNHILTAAHCVSSVGITPVDASTLAVRLGTINQYAGGSIVN--------VKSVIIHPS-- 110

  Fly   128 YQRGANNLALLFLDREFPLTYKINTICLP--TQKRS-------LSSTRCIVAGWGKYQFSDTHYG 183
            |....:::|:|.||.....:.:|..|.||  |.:.:       .:.|...|||||  :.||....
  Fly   111 YGNFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWG--ELSDGTAS 173

  Fly   184 GVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQ 248
            ...:|.:...:.|.:|:     ...|..|   ..::|....:....|.||.|.|:.    :|.|.
  Fly   174 YKQQKANYNTLSRSLCE-----WEAGYGY---ESVVCLSRAEGEGICRGDAGAAVI----DDDKV 226

  Fly   249 FEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
            ...:...|:| .|..| .|...|.|..:..||
  Fly   227 LRGLTSFNFG-PCGSK-YPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 62/248 (25%)
Tryp_SPc 50..280 CDD:214473 60/246 (24%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 65/269 (24%)
Tryp_SPc 29..259 CDD:238113 67/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.