DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG9676

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:292 Identity:76/292 - (26%)
Similarity:124/292 - (42%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFEAWTLIVALFVLGV-AENVENLQQIEELKCGYGNPDAVKVQFNVTEG-QAKPAEFPWTIAVIH 63
            |...||.::.|...|| |:|                 |:| |:..:..| :|:..:||..|::..
  Fly     1 MLPFWTSLLVLCAAGVLAQN-----------------DSV-VEPRIVGGTKAREGQFPHQISLRR 47

  Fly    64 NRSLVGGGSLITPDIVLTAAHRIFNKD----VEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHK 124
            ..|...|||:|:.|.|:||||.:...:    ..::.:.||.....|...:.|     |..:.:|.
  Fly    48 RGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVP-----VATVTVHP 107

  Fly   125 SFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGV---L 186
              ||....:::|:|.|.........|..|.|.|:.....:| ..::|||    :.:..|.:   |
  Fly   108 --NYNSNGHDVAVLRLRNSLTFNSNIAAIKLATEDPPNDAT-VDISGWG----AISQRGPISNSL 165

  Fly   187 KKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQ 251
            ..:.:..:.|..||    ||.|.|   ||...:|....||..||.||.||    |.|   .|.:.
  Fly   166 LYVQVKALSRESCQ----KTYLRQ---LPETTMCLLHPKDKGACYGDSGG----PAT---YQGKL 216

  Fly   252 IGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQ 283
            :|:.::.:|...:..|..|..|.:.:.||.::
  Fly   217 VGLASFVIGGCGRAAPDGYERVSKLRNWIAEK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 64/239 (27%)
Tryp_SPc 50..280 CDD:214473 62/236 (26%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 63/243 (26%)
Tryp_SPc 28..248 CDD:238113 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.