DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG33160

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:264 Identity:72/264 - (27%)
Similarity:118/264 - (44%) Gaps:37/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YGNPDAVKVQFNVTEGQAKP-AEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVV 96
            |.:||:|::|..:..|.... .|..:.:.|..:..|. ||||:.|..|:||||.::||:..|..:
  Fly    22 YAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELC-GGSLVKPRWVITAAHCVYNKNKNDFKI 85

  Fly    97 SAGEWEYGSALEKY-PFEEAFVLKMV----IHKSFNYQRGANNLALLFLDREFPLTYKINTICLP 156
                  ||.|..:. |:.   |::.|    |...||.:....::|.|.|:.:. :...|.||.|.
  Fly    86 ------YGGASNQAGPYA---VIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLA 140

  Fly   157 TQK---RSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGL 218
            .|.   |:|..    |:|||......|.....:..:.:|:..|..|....|..     :.:.|.:
  Fly   141 AQSVPARALVK----VSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGI-----HRITRSM 196

  Fly   219 ICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQ 283
            :||......|:|.||.||.|.       .:.:..|||::|.||... :|..||.|.|.:.|..:.
  Fly   197 VCAARLYKKDSCDGDSGGPLV-------YRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRV 253

  Fly   284 IKEN 287
            ::::
  Fly   254 VEQH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 66/241 (27%)
Tryp_SPc 50..280 CDD:214473 65/238 (27%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/243 (27%)
Tryp_SPc 34..253 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.