DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG32523

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:300 Identity:80/300 - (26%)
Similarity:128/300 - (42%) Gaps:67/300 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTLIVALF-----VLG--VAENVENLQQIEELKCGYGNPDAVKVQFNVTEG-QAKPAEFPWTIAV 61
            ||:::.|.     :||  ||:|     |.|.           .::..:..| :||..:||..|::
  Fly     6 WTVLLLLLCGVQVILGQDVAQN-----QSES-----------AIEPRIVGGIKAKQGQFPHQISL 54

  Fly    62 IHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEW--EYGSALEKYPFEEAFVLKMVIHK 124
            ........||.:|:...|:||.|.:  |...| ||.|..|  :.||.|.........|.::::|.
  Fly    55 RLRGEHYCGGVIISATHVITAGHCV--KHGND-VVPADLWSIQAGSLLLSSDGVRIPVAEVIMHP 116

  Fly   125 SFNYQRGA-NNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCI---VAGWG----KYQFSDTH 181
              ||..|. |:||:|.|  :.|||:..|...:  |..:.....|:   ::|||    |...||: 
  Fly   117 --NYATGGHNDLAVLRL--QSPLTFDANIAAI--QLATEDPPNCVAVDISGWGNIAEKGPLSDS- 174

  Fly   182 YGGVLKKIDLPIVPRHICQDQLRKTRLGQNYT-LPRGLICAGGEKDNDACTGDGGGALFCPMTED 245
                |..:.:..:.|..|:...        |: ||..:||....|::.||.||.||    |.|..
  Fly   175 ----LLFVQVTSISRGACRWMF--------YSRLPETMICLLHSKNSGACYGDSGG----PATYG 223

  Fly   246 PKQFEQIGIVN--WGVGCKEKNVPATYTDVFEFKPWIVQQ 283
            .|   .:|:.:  .|.|| .:..|..|..:.:.:.||.::
  Fly   224 GK---VVGLASLLLGGGC-GRAAPDGYLRISKVRAWIAEK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 69/245 (28%)
Tryp_SPc 50..280 CDD:214473 67/242 (28%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/249 (27%)
Tryp_SPc 37..219 CDD:238113 59/207 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.