DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG32376

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:258 Identity:66/258 - (25%)
Similarity:115/258 - (44%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NP--DAVKVQ----FNVTEGQAKP-AEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVE 92
            ||  :|::.|    ..:..|:..| .|.|:..::.:....|.|..:|....:|||.|..|....:
  Fly    50 NPFINALEAQESFPTRIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFGPPEK 114

  Fly    93 DIV-VSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLP 156
            ..| |.:.:...|..|.       .|.|:|...::|.....::||::.|.........:..:.||
  Fly   115 YTVRVGSDQQRRGGQLR-------HVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLP 172

  Fly   157 TQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICA 221
            :.|.:....:.:|:|||....:..:....|:::.:..:.|..||...:|..|    .:.:.:|||
  Fly   173 STKTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGL----KIYKDMICA 233

  Fly   222 GGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQI 284
             ...:.|:|:||.||    |:|.....:   |||:||:||..||.|..|.:...:.|||.:.|
  Fly   234 -SRTNKDSCSGDSGG----PLTSRGVLY---GIVSWGIGCANKNYPGVYVNCKRYVPWIKKVI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 60/234 (26%)
Tryp_SPc 50..280 CDD:214473 58/231 (25%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 59/237 (25%)
Tryp_SPc 66..287 CDD:238113 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.