DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss30

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:273 Identity:83/273 - (30%)
Similarity:128/273 - (46%) Gaps:37/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGYGNPDAVKVQFNVTEGQ-AKPAEFPWTIAV-IHNRSLVGGGSLITPDIVLTAAH---RIFNKD 90
            ||:.. ||.|    :..|| |...::||.::: |.....:.|||||....||||||   |..|..
Mouse    65 CGHSR-DAGK----IVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPS 124

  Fly    91 VEDIVVSAGEWEYG---SALEKYPFEEAFVLKMVIHKSFNY-QRGANNLALLFLDREFPL-TYKI 150
            ...:.|.      |   |.||.:....| |..:.:|.::.: ...:.::||:.||.  || ..:.
Mouse   125 FYHVKVG------GLTLSLLEPHSTLVA-VRNIFVHPTYLWADASSGDIALVQLDT--PLRPSQF 180

  Fly   151 NTICLPTQKRSLS-STRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQD--QLRKTRLGQNY 212
            ..:|||..:..|: .|.|.|.|||..|..|  ...||:::.:|::....|:.  ..:.:.|....
Mouse   181 TPVCLPAAQTPLTPGTVCWVTGWGATQERD--MASVLQELAVPLLDSEDCEKMYHTQGSSLSGER 243

  Fly   213 TLPRGLICAG---GEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVF 274
            .:...::|||   |:|  |:|.||.||.|.|.:.   ..:.|:||.:||:||.....|..||.|.
Mouse   244 IIQSDMLCAGYVEGQK--DSCQGDSGGPLVCSIN---SSWTQVGITSWGIGCARPYRPGVYTRVP 303

  Fly   275 EFKPWIVQQIKEN 287
            .:..||.:.:.||
Mouse   304 TYVDWIQRILAEN 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 74/247 (30%)
Tryp_SPc 50..280 CDD:214473 72/244 (30%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.