DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss42

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:328 Identity:92/328 - (28%)
Similarity:141/328 - (42%) Gaps:73/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EAWT----LIVALFVLGVAENVENLQQIEELKCGYGNPDAVKV-----------------QFNVT 46
            |||.    |..:.|..|::|:.           |..:|....|                 .|::.
  Rat    23 EAWAAASILSTSGFPSGLSESP-----------GENSPPPTPVHTSKVASQGSTTRFPFTNFSIV 76

  Fly    47 EGQ----------AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRI-----FNKDVEDIVV 96
            .||          |:..::||.:::......|.||||:....||||||.|     :|..:.|..|
  Rat    77 CGQPLMKIMGGVDAEEGKWPWQVSLRVRHMHVCGGSLLNSQWVLTAAHCIHSRVQYNVKMGDRSV 141

  Fly    97 SAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGA-NNLALLFLDREFPLTYKINTICLPTQKR 160
                :...::| ..|.:..||     |..|:..... |::|||.|.:....|..|:.||:||...
  Rat   142 ----YRQNTSL-VIPIQNIFV-----HPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVPTGTF 196

  Fly   161 SL-SSTRCIVAGWGKYQFSDTHYGG------VLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGL 218
            .: :.|:|.|.||||     ...|.      :|:::|..|:....|.:.|:|........:.||:
  Rat   197 HVKAGTKCWVTGWGK-----PDPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGM 256

  Fly   219 ICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQ 283
            :||..|...|||.||.||.|.|   |...::.|||:|:||:||..|..|..||||..:..|::..
  Rat   257 VCAYKEGGKDACQGDSGGPLSC---EFDNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWLITV 318

  Fly   284 IKE 286
            :.:
  Rat   319 VNQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 79/245 (32%)
Tryp_SPc 50..280 CDD:214473 78/242 (32%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 78/248 (31%)
Tryp_SPc 84..315 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.