DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Tpsb2

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:268 Identity:79/268 - (29%)
Similarity:124/268 - (46%) Gaps:33/268 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDAVKVQFNVTEG-QAKPAEFPWTIAVIHNRSL---VGGGSLITPDIVLTAAHRIFNKDVEDIVV 96
            |..||.:..:..| :|..:::||.:::....|.   ..|||||.|..||||||.:      .:.:
  Rat    21 PCPVKQRVGIVGGREASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCV------GLHI 79

  Fly    97 SAGEWEYGSALEKYPF---EEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQ 158
            .:.|.......|:|.:   :...|.:.|:|..:.......::|||.|:....::..|:...||..
  Rat    80 KSPELFRVQLREQYLYYADQLLTVNRTVVHPHYYTVEDGADIALLELENPVNVSTHIHPTSLPPA 144

  Fly   159 KRSL-SSTRCIVAGWGKYQFSD---THYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYT------ 213
            ..:. |.|.|.|.|||.....:   ..|  .||::.:|||...:|.   ||...|. ||      
  Rat   145 SETFPSGTSCWVTGWGDIDSDEPLLPPY--PLKQVKVPIVENSLCD---RKYHTGL-YTGDDVPI 203

  Fly   214 LPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKP 278
            :..|::|||..: :|:|.||.||.|.|.:   ...:.|.|:|:||.||.|.|.|..||.|..:..
  Rat   204 VQDGMLCAGNTR-SDSCQGDSGGPLVCKV---KGTWLQAGVVSWGEGCAEANRPGIYTRVTYYLD 264

  Fly   279 WIVQQIKE 286
            ||.:.:.:
  Rat   265 WIHRYVPQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 75/248 (30%)
Tryp_SPc 50..280 CDD:214473 73/245 (30%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 76/253 (30%)
Tryp_SPc 30..266 CDD:214473 74/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.