DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss34

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:322 Identity:87/322 - (27%)
Similarity:143/322 - (44%) Gaps:64/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WTLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEG-QAKPAEFPWTIAV-IHNRSL 67
            |.|.:.|..||....:              .||:.:....:..| ....:.|||.::: .:|..|
  Rat     7 WFLFLTLPCLGSTMPL--------------TPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKL 57

  Fly    68 -----VGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAF-VLKMVIHKSF 126
                 :.|||||.|..||||||.:..|::|   .|....:.|. |..|..::.. |.|::.|..|
  Rat    58 SKWEHICGGSLIHPQWVLTAAHCVELKEME---ASCFRVQVGQ-LRLYENDQLMKVAKIIRHPKF 118

  Fly   127 NYQ---RGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRC-IVAGWGKYQF-----SDTHY 182
            :.:   .|..::|||.||....|:.:::.:.||...:.:||.:. .|||||..:.     ...| 
  Rat   119 SEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCH- 182

  Fly   183 GGVLKKIDLPIVPRHICQDQL-------RKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFC 240
               |:::.:|||....|:.:.       |.|::     :...::|||.| ..|:|..|.||.|.|
  Rat   183 ---LREVAVPIVGNSDCEQKYRTYSSLDRTTKI-----IKDDMLCAGME-GRDSCQADSGGPLVC 238

  Fly   241 PMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI---VQQIKE------NLYTPDN 293
            ...   ..:.|:|:|:||:||...:.|..||.|..:..||   |.:..|      .::||::
  Rat   239 RWN---CSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWIHGYVPKFPEPSMGPDRIHTPED 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 76/258 (29%)
Tryp_SPc 50..280 CDD:214473 73/252 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 75/259 (29%)
Tryp_SPc 33..275 CDD:214473 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.