DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss30

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:306 Identity:85/306 - (27%)
Similarity:130/306 - (42%) Gaps:55/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EAWTLIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEGQAKP-AEFPWTIAV-IHNR 65
            |:|...:.|.:|.:......    :.|..|.|         .:..||..| ..:||.::: ....
  Rat     2 ESWARCIFLLLLQILTGGRG----DILHSGAG---------KIVGGQDAPEGRWPWQVSLRTEKE 53

  Fly    66 SLVGGGSLITPDIVLTAAH---RIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFN 127
            ..:.|||||....||||||   |..|.....:.|.      |..|.   ..|.....:.:...|.
  Rat    54 GHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVG------GLTLS---LTEPHSTLVAVRNIFV 109

  Fly   128 Y------QRGANNLALLFLDREFPL-TYKINTICLPTQKRSLS-STRCIVAGWGKYQFSDTH--- 181
            |      ...:.::|||.||.  || ..:.:.:|||..:..|: .|.|.|.|||.     ||   
  Rat   110 YPTYLWEDASSGDIALLRLDT--PLQPSQFSPVCLPQAQAPLTPGTVCWVTGWGA-----THERE 167

  Fly   182 YGGVLKKIDLPIVPRHICQD--QLRKTRLGQNYTLPRGLICAG---GEKDNDACTGDGGGALFCP 241
            ...||:::.:|::....|:.  .:.:|.|.....:...::|||   |:|  |:|.||.||.|.|.
  Rat   168 LASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQK--DSCQGDSGGPLVCA 230

  Fly   242 MTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIKEN 287
            :.   ..:.|:||.:||:||...|.|..||.|.::..||.:.:.||
  Rat   231 IN---SSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLAEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 74/253 (29%)
Tryp_SPc 50..280 CDD:214473 72/250 (29%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.