DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG33225

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:302 Identity:78/302 - (25%)
Similarity:136/302 - (45%) Gaps:38/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFEAWTLIVALFVLGVAENVENLQQIEELKCG-YGNPDAVKVQFNVTEG-QAKPAEFPWTIAVIH 63
            :|.|..:::|..|||.......|...:   || ..:|..::   .|..| .|.....||.:.|:.
  Fly    18 IFVAEIVLLASLVLGARLGSSTLLTND---CGTTRHPSRIR---RVVGGNDADRFANPWMVMVLG 76

  Fly    64 NRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYG-SALEKYPFEEAF-VLKMVIHKSF 126
            ..::...|||||...|||:|..:.:...:.|:   ||::.. ::.:.....:.. :.:.:||..|
  Fly    77 ENNVFCSGSLITRLFVLTSASCLLSLPKQVIL---GEYDRNCTSADCTSIRQVIDIDQKIIHGQF 138

  Fly   127 NYQRGAN-NLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVA-GWGKYQFSDTHYGGVLKKI 189
            ..:.... ::|||.|.::..::..:..|||...::...|.:...| |||..::::.  ..:|:.:
  Fly   139 GLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTTEWNEP--STILQTV 201

  Fly   190 DLPIVPRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTED--------P 246
            .|..:.|..|     |.||.||  :....:|.||.: .|.|:||.||.|...:..|        .
  Fly   202 TLSKINRKYC-----KGRLRQN--IDASQLCVGGPR-KDTCSGDAGGPLSLTLKIDGDGKWNNKS 258

  Fly   247 KQFEQIGIVNWG-VGCKEKNVPATYTDVFEFKPWIVQQIKEN 287
            :.| .||||::| ..|....|   ||:|..:..|||:.|.::
  Fly   259 RAF-LIGIVSYGSSSCSGIGV---YTNVEHYMDWIVRTINKS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 65/245 (27%)
Tryp_SPc 50..280 CDD:214473 62/242 (26%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 64/249 (26%)
Tryp_SPc 57..292 CDD:238113 67/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.