DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Tpsg1

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:287 Identity:75/287 - (26%)
Similarity:112/287 - (39%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GYGNPDAVKVQFNVTEGQAKPA-EFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDV--ED 93
            |.|:|........:..|.|.|| .:||..::..::..|.||||::|:.|||||| .|:..|  .|
Mouse    74 GCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAH-CFSGSVNSSD 137

  Fly    94 IVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQR-------------GANNLALLFLDREFP 145
            ..|..||                 |.:.:...|:..:             .:.::||:.|.....
Mouse   138 YQVHLGE-----------------LTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVA 185

  Fly   146 LTYKINTICLPTQKRSL-SSTRCIVAGWGKYQFSDTHYGGV---------LKKIDLPIVPRHICQ 200
            |:.::..:|||...... ...:|.|.|||        |.|.         |::..:.:|....| 
Mouse   186 LSSQVQPVCLPEASADFYPGMQCWVTGWG--------YTGEGEPLKPPYNLQEAKVSVVDVKTC- 241

  Fly   201 DQLRKTRLGQNYTLPRG------LICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGV 259
                    .|.|..|.|      ::||.|  ..|||..|.||.|.|.:.   ..::|.|:|:||.
Mouse   242 --------SQAYNSPNGSLIQPDMLCARG--PGDACQDDSGGPLVCQVA---GTWQQAGVVSWGE 293

  Fly   260 GCKEKNVPATYTDVFEFKPWIVQQIKE 286
            ||...:.|..|..|..:..||...|.|
Mouse   294 GCGRPDRPGVYARVTAYVNWIHHHIPE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 69/264 (26%)
Tryp_SPc 50..280 CDD:214473 67/261 (26%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 70/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.