DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and TPSG1

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:270 Identity:82/270 - (30%)
Similarity:119/270 - (44%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GYGNPDAVKVQFNVTEGQAKPA-EFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDV--ED 93
            |.|.|........:..|.|.|| .:||..::...|..|.||||::|..|||||| .|:..:  .|
Human    50 GCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAH-CFSGSLNSSD 113

  Fly    94 IVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRG-ANNLALLFLDREFPLTYKINTICLPT 157
            ..|..||.|    :...| ..:.|.::::|.|.:.|.| :.::||:.|.....|:.:|..:|||.
Human   114 YQVHLGELE----ITLSP-HFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSRILPVCLPE 173

  Fly   158 QKRSL-SSTRCIVAGWGKYQFSDTHYGG------VLKKIDLPIVPRHICQDQLRKTRLGQNYTLP 215
            ..... ...||.|.|||.     |..|.      .|:::.:.:|....|:         ::|..|
Human   174 ASDDFCPGIRCWVTGWGY-----TREGEPLPPPYSLREVKVSVVDTETCR---------RDYPGP 224

  Fly   216 RG------LICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVF 274
            .|      ::||.|  ..|||..|.||.|.|.:.   ..:.|.|.|:||.||...|.|..||.|.
Human   225 GGSILQPDMLCARG--PGDACQDDSGGPLVCQVN---GAWVQAGTVSWGEGCGRPNRPGVYTRVP 284

  Fly   275 EFKPWIVQQI 284
            .:..||.:.|
Human   285 AYVNWIRRHI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 77/249 (31%)
Tryp_SPc 50..280 CDD:214473 75/246 (30%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 76/252 (30%)
Tryp_SPc 63..293 CDD:238113 78/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.