DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG30287

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:312 Identity:79/312 - (25%)
Similarity:128/312 - (41%) Gaps:68/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQ-----FNVTEGQAKPAEF---PWTIAVIH 63
            |::||..|.|......|           :|..|..:     :.|..|  |||:.   ||.:.:|.
  Fly    10 LLIALVFLKVQGQPHLL-----------DPQCVTARSEPGLYRVING--KPADLFSNPWMVIIIE 61

  Fly    64 NRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPF------EEAFVLKMVI 122
            ...:..|||||||..|||||| ..::....:.|..|:::...|::...:      .|..|.:..:
  Fly    62 RGMMKCGGSLITPRYVLTAAH-CKSETKSQLTVRLGDYDVNQAVDCSSYGCIPRPREINVTRTYV 125

  Fly   123 HKSF-NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSST--RCIVAGWGKYQFSDTHYGG 184
            ...: |:::  |::|||.|:........|.:|||.....:.||.  :.:|      :|:.|.:|.
  Fly   126 PSHYTNFRK--NDIALLRLETTVQYGDNIRSICLLMGDYTWSSNILKNLV------KFNTTGWGR 182

  Fly   185 VLKKIDLPIVPR------HI--CQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCP 241
            ...:|:.|::.:      |:  |.....|       .|.:..||. .......|.||.||    |
  Fly   183 TESRINSPVLQQASLTHHHLSYCAQVFGK-------QLDKSHICV-ASSTGSTCQGDSGG----P 235

  Fly   242 MTE-----DPKQFEQIGIVNWG-VGCKEKNVPATYTDVFEFKPWIVQQIKEN 287
            :|.     ..::....|:|::| |.|..   |..||:|..|..||....|:|
  Fly   236 LTARVRIGSERRVILFGVVSYGAVHCFG---PTVYTNVIHFANWIELHTKKN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 67/258 (26%)
Tryp_SPc 50..280 CDD:214473 65/255 (25%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 67/261 (26%)
Tryp_SPc 42..280 CDD:238113 69/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.