DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and CG30088

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:281 Identity:76/281 - (27%)
Similarity:116/281 - (41%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGYGNPDAVKVQFNVT-------EGQAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAH--RI 86
            ||      |..:.||.       |...|.|  |:...:.::..:..||::|:...:|||||  |.
  Fly    33 CG------VSYESNVATRIVRGKEAMLKSA--PFMAYLYYSSEIHCGGTIISSRYILTAAHCMRP 89

  Fly    87 FNKDVEDIVVSAGEWEY--------GSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDRE 143
            :.|      |..||.:.        ||.  ..|.||..::....:|.|: :..||::|||.|.|.
  Fly    90 YLK------VRLGEHDITRNPDCQGGSC--SPPAEEFDIVLATKYKRFD-RFLANDIALLKLSRN 145

  Fly   144 FPLTYKINTICLPTQKRSLSSTRCIVA-GWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTR 207
            ......|..|||.....:..:.....| |||  |....|...||:...|.......|:..|    
  Fly   146 IRFNVHIQPICLILNPAAAPNVHEFQAFGWG--QTETNHSANVLQTTVLTRYDNRHCRSVL---- 204

  Fly   208 LGQNYTLPRGL--ICAGGEKDNDACTGDGGGALFCPMTEDPK-QFEQIGIVNWGVG-CKEKNVPA 268
                 ::|..:  :|.|.: .:|.|:||.||.|...:..|.. ::.|:|||::|.. |:.   |.
  Fly   205 -----SMPITINQLCVGFQ-GSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQS---PG 260

  Fly   269 TYTDVFEFKPWIVQQIKENLY 289
            .||.|..:..||...::.|.|
  Fly   261 VYTYVPNYIRWIRYVMQSNGY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 68/247 (28%)
Tryp_SPc 50..280 CDD:214473 66/244 (27%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 67/253 (26%)
Tryp_SPc 45..273 CDD:238113 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.