DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss42

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:126/266 - (47%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VQFNVTEGQ----------AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIV 95
            :.|::..||          |:..::||.::|......|.|||||....||||||.|:::...::.
Mouse    66 MNFSLVCGQPFMKIMGGVDAEEGKWPWQVSVRVRHMHVCGGSLINSQWVLTAAHCIYSRIQYNVK 130

  Fly    96 V-SAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGA-NNLALLFLDREFPLTYKINTICLPTQ 158
            | ....:...::| ..|.:..||     |..|:..... |::|||.|......|..|..:|:|::
Mouse   131 VGDRSVYRQNTSL-VIPIKTIFV-----HPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSE 189

  Fly   159 KRSL-SSTRCIVAGWGKYQFSDTHYGG-------VLKKIDLPIVPRHICQDQLRKTRLGQNYTLP 215
            ...: :.|:|.|.||||.      ..|       :|:::|..::....|.:.|:|........:.
Mouse   190 SFPVKAGTKCWVTGWGKL------VPGAPDVPTEILQEVDQNVILYEECNEMLKKATSSSVDLVK 248

  Fly   216 RGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
            ||::|...|:..|||.||.||.:.|   |...::.|:|:|:||:.|..|..|..||||..:..|:
Mouse   249 RGMVCGYKERGKDACQGDSGGPMSC---EFENKWVQVGVVSWGISCGRKGYPGVYTDVAFYSKWL 310

  Fly   281 VQQIKE 286
            :..:.:
Mouse   311 IAVVNQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 72/242 (30%)
Tryp_SPc 50..280 CDD:214473 71/239 (30%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 71/245 (29%)
Tryp_SPc 79..310 CDD:238113 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.