DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and TPSD1

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:228 Identity:63/228 - (27%)
Similarity:111/228 - (48%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PDAVKVQFNVTEGQAKP-AEFPWTIAV-------IHNRSLVGGGSLITPDIVLTAAHRIFNKDVE 92
            |.....|..:..||..| :::||.:::       :|    ..|||||.|..||||||.: ..|::
Human    29 PGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMH----FCGGSLIHPQWVLTAAHCV-EPDIK 88

  Fly    93 DIVVSAGEWEYGSAL-----EKYPFEEAFVL---KMVIHKSFNYQRGANNLALLFLDREFPLTYK 149
            |:          :||     |::.:.:..:|   ::::|..|...:...::|||.|:....::..
Human    89 DL----------AALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSH 143

  Fly   150 INTICLPTQKRSL-SSTRCIVAGWGKYQFSDTH----YGGVLKKIDLPIVPRHICQDQLRK-TRL 208
            |:|:.||....:. ....|.|.|||... ::.|    |  .||::::|:|..|:|..:... ...
Human   144 IHTVTLPPASETFPPGMPCWVTGWGDVD-NNVHLPPPY--PLKEVEVPVVENHLCNAEYHTGLHT 205

  Fly   209 GQNYTLPR-GLICAGGEKDNDACTGDGGGALFC 240
            |.::.:.| .::|||.| ::|:|.||.||.|.|
Human   206 GHSFQIVRDDMLCAGSE-NHDSCQGDSGGPLVC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 59/214 (28%)
Tryp_SPc 50..280 CDD:214473 59/214 (28%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 61/219 (28%)
Tryp_SPc 38..240 CDD:214473 61/219 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.