DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and PRSS55

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:253 Identity:81/253 - (32%)
Similarity:125/253 - (49%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VTEG-QAKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDV--EDIVVSAGEWEYGSA 106
            :|.| :|:..||||.:::........|||::....:|||||.::::::  |::.|..|.    :.
Human    68 ITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELFPEELSVVLGT----ND 128

  Fly   107 LEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAG 171
            |.....|...|..:::||.|......|::|||.|.....|......||||||....:...|.|||
Human   129 LTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLPTQPGPATWRECWVAG 193

  Fly   172 WGKYQFSDTHYGGVLKKIDLPIVPRHI-----CQDQLRKTRLGQNYTLPRGLICAGGEKDN-DAC 230
            ||:...:|.:    ..|.||...|..|     |.....|        |.:.::|||.:.:: |||
Human   194 WGQTNAADKN----SVKTDLMKAPMVIMDWEECSKMFPK--------LTKNMLCAGYKNESYDAC 246

  Fly   231 TGDGGGALFCPMTEDP-KQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI--VQQIK 285
            .||.||.|.|  |.:| :::.|:||::||..|.|||.|..||.:..:..||  |.|::
Human   247 KGDSGGPLVC--TPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 78/243 (32%)
Tryp_SPc 50..280 CDD:214473 75/238 (32%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 77/244 (32%)
Tryp_SPc 68..298 CDD:238113 79/247 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.