DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and Prss29

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:309 Identity:90/309 - (29%)
Similarity:140/309 - (45%) Gaps:67/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIVALFVLGVAENVENLQQIEELKCGYGNPDAVKVQFNVTEGQAKP-AEFPWTIAV--------- 61
            |.:.||.||.:            ..|...|....|...:..|.:.| .::||.:::         
Mouse     5 LCLTLFFLGCS------------IAGTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAF 57

  Fly    62 -IHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIV--VSAGE-WEYGSALEKYPFEEAFVLKMVI 122
             :||    .|||:|.|..||||||.|..:|.:..|  :..|| :.||..      |...|.:::|
Mouse    58 WVHN----CGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGK------ELLSVSRVII 112

  Fly   123 HKSFNYQRGANNLALLFLD---REFPLTYKINTICLPTQKRSLSSTR---CIVAGWGKYQFSDTH 181
            |..|.:....:::|||.|.   :.||   .:..:.||::  ||..|:   |.|.|||..   .||
Mouse   113 HPDFVHAGLGSDVALLQLAVSVQSFP---NVKPVKLPSE--SLEVTKKDVCWVTGWGAV---STH 169

  Fly   182 ------YGGVLKKIDLPIVPRHICQDQ----LRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGG 236
                  |.  |:::.:.|:...:|::.    .|....||...| :.::|||.: ..|:|.||.||
Mouse   170 RSLPPPYR--LQQVQVKIIDNSLCEEMYHNATRHRNRGQKLIL-KDMLCAGNQ-GQDSCYGDSGG 230

  Fly   237 ALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIK 285
            .|.|.:|   ..:..:|:|:||.||..::.|..|..|..|.|||.||::
Mouse   231 PLVCNVT---GSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQ 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 79/262 (30%)
Tryp_SPc 50..280 CDD:214473 77/259 (30%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 80/267 (30%)
Tryp_SPc 31..271 CDD:214473 78/264 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.