DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:283 Identity:76/283 - (26%)
Similarity:117/283 - (41%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NVENLQQIEELKCGYGNPDAVKVQFNVTEG-----QAKPAEFPWTIAVIHNRSLVGGGSLITPDI 78
            |.:.|.......||.       :..|.:.|     .:....:||..::........|||||..:.
Zfish   285 NSQALDSPSAAVCGI-------IPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEW 342

  Fly    79 VLTAAHRIFN--KDVEDIVVSAGEWEYGSALEKY-PFEEAFVLKMVI-HKSFNYQRGANNLALLF 139
            ||:||| .||  ::...:.|..|.    ....|| |...:..:|.|| |..:|.....|::||:.
Zfish   343 VLSAAH-CFNGQRNGFYLTVILGP----KTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVR 402

  Fly   140 LDREFPLTY--KINTICLPTQKRSLSS-TRCIVAGWGKYQFSDTHYGGV-------LKKIDLPIV 194
            |  .||:|:  .|..:||..:....:| |...:..|  ...||    ||       .:::::|::
Zfish   403 L--SFPITFTDSIRPVCLAAEGSVFNSDTESWITTW--RNISD----GVPLPSPKIFQEVEVPVI 459

  Fly   195 PRHICQDQLRKTRLGQNYTLPRGLICAGGEKD-NDACTGDGGGALFCPMTEDPKQ-FEQIGIVNW 257
            ....|........:..|      :||||..|: .|.|.||.||    ||..:... :.|.|||::
Zfish   460 GNRQCNCLYGVGSITDN------MICAGLLKEGKDLCQGDSGG----PMVSNQSSVWVQSGIVSF 514

  Fly   258 GVGCKEKNVPATYTDVFEFKPWI 280
            |.||.:...|..||.|..::.||
Zfish   515 GSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 70/247 (28%)
Tryp_SPc 50..280 CDD:214473 68/245 (28%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 68/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.