DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and zgc:165423

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:259 Identity:71/259 - (27%)
Similarity:114/259 - (44%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AKPAEFPWTIAVIHNRSLVGGGSLITPDIVLTAAHRI-FNKDVEDIVVSAGEWEYGSALEKYPFE 113
            |....:||..::..:.|...|||||:...:|:|||.. .|.:..|..|..|  .....|......
Zfish    44 ASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPSNPNPSDYTVYLG--RQSQDLPNPNEV 106

  Fly   114 EAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYK--INTICLPTQKRSLSSTRCIVAGWGKYQ 176
            ...|.::::|..:......|::|||.|..  |:|:.  |..:||.....:..:....:.|||   
Zfish   107 SKSVSQVIVHPLYQGSTHDNDMALLHLSS--PVTFSNYIQPVCLAADGSTFYNDTMWITGWG--- 166

  Fly   177 FSDTHYGGV-------LKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG---GEKDNDACT 231
               |...||       |:::::|||..::|     ....|...::...::|||   |.|  |:|.
Zfish   167 ---TIESGVSLPSPQILQEVNVPIVGNNLC-----NCLYGGGSSITNNMMCAGLMQGGK--DSCQ 221

  Fly   232 GDGGGALFCPMTEDPKQFE---QIGIVNWGVGCKEKNVPATYTDVFEFKPWIVQQIKENLYTPD 292
            ||.||    ||.  .|.|.   |.|:|::|.||.:.|.|..|..|.:::.||.|.::.:....|
Zfish   222 GDSGG----PMV--IKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQYVRASFIPVD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 69/248 (28%)
Tryp_SPc 50..280 CDD:214473 67/245 (27%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 67/245 (27%)
Tryp_SPc 38..269 CDD:238113 69/247 (28%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.