DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and zgc:163079

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:253 Identity:75/253 - (29%)
Similarity:100/253 - (39%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NVTEGQAKPAEFPW--TIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAG-EWEYGS 105
            |.|:|     .:||  :|.:........|||||....|||.|.........||||..| :.:.||
Zfish    41 NATQG-----SWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNGS 100

  Fly   106 ALEKYPFE-EAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYK--INTICLPTQ-KRSLSSTR 166
                .|:| ...|.|::.|.  ||....:|||||.|..  |:|:.  |..:||... ...:..|.
Zfish   101 ----NPYEISRTVTKIIKHP--NYNSLDSNLALLKLSS--PVTFSDYIKPVCLAAAGSVFVDGTA 157

  Fly   167 CIVAGWGKYQ----FSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG--GEK 225
            ..|.|||...    ..:.....||::::.|||....|       .......:...|:|||  .|.
Zfish   158 SWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFEC-------NAAYGGIITNKLLCAGYLNED 215

  Fly   226 DNDACTGDGGGALFCPMTEDPKQ---FEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
            ....|.||.||.|..      ||   :.|.|:|..|. |.....|..|..|.|::.||
Zfish   216 GKAPCAGDVGGPLVI------KQGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 72/247 (29%)
Tryp_SPc 50..280 CDD:214473 70/245 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 73/251 (29%)
Tryp_SPc 36..267 CDD:238113 75/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.