DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18478 and LOC100004427

DIOPT Version :9

Sequence 1:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:244 Identity:67/244 - (27%)
Similarity:98/244 - (40%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NVTEGQAKPAEFPWTIAVIHNRSLVG----GGSLITPDIVLTAAHRIFNKDVEDIVVSAGEWEYG 104
            |.|||     .:||..::  |....|    .||||:...|||||......:|.|:|:..|.....
Zfish    41 NATEG-----SWPWQASI--NFKSTGQFFCSGSLISERWVLTAASCFQRINVSDVVIYLGRLTTN 98

  Fly   105 SALEKYPFEEAFVLKMVIHKSFNYQRGANNLALLFLDREFPLTYKINTICLPTQ-KRSLSSTRCI 168
            .:   .|:|   :.:.||..|.     ..::||:.|......|..|..:||... ...:..|...
Zfish    99 GS---NPYE---IPRTVIQVSV-----TEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVDGTESW 152

  Fly   169 VAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNYTLPRGLICAG--GEKDNDACT 231
            |.|||....::.....:||:::.|||....|.:....|.|.       .:||||  .|.....|.
Zfish   153 VTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNLD-------NVICAGFVNETGKAPCW 210

  Fly   232 GDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPWI 280
            .|.|..|   :|....|:.|.|:|.: ..|.:...|..|..|.|::.||
Zfish   211 EDFGSPL---VTRQGSQWIQSGVVVF-TFCGQNGFPTLYARVSEYEEWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 63/238 (26%)
Tryp_SPc 50..280 CDD:214473 61/236 (26%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 65/242 (27%)
Tryp_SPc 36..257 CDD:238113 67/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.