DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and gzma

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:230 Identity:56/230 - (24%)
Similarity:102/230 - (44%) Gaps:30/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 WMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLP--SVDVPI 182
            |||::  ....::..||.||....|:||....|: :.|.:.|..|....|..::::.  :.::| 
Zfish    40 WMVSI--QVNQNHKCGGILIHKEWVLTAAHCKED-SYSSVTVLIGSLSLSKGSQRIAIHNYEIP- 100

  Fly   183 RSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFD-FSRCIFTGWGKNSFDDPS 246
                  ..||.:...:::.|:.|.:.:.:    .|..:|...|:.. .::|:..|||...:....
Zfish   101 ------ETFNKKTKKDDIMLIRLSKKVKA----KPYKIPKKEKDVQPGTKCVVRGWGTTDYKGKQ 155

  Fly   247 YMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGG-EPGKDSCEGDGGSPLACAIKDNP 310
            ..:.|:.:.:.||.|..|.:    ||..:..:...::|||. :..:.:|.||.|.||.|      
Zfish   156 ASDKLQMLEVLVVDRVQCNR----YYNRNPVITKDMLCAGNTQQHRGTCLGDSGGPLEC------ 210

  Fly   311 QRYELAGIVNFGVDCGLPGVPAVYTNVA-NVIEWI 344
             ...|.|:::....||.|..|.|||.:: ..|.||
Zfish   211 -EKNLVGVLSGSHGCGDPKKPTVYTLLSKRHITWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 54/228 (24%)
Tryp_SPc 113..344 CDD:238113 54/228 (24%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.