DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and zgc:153968

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:228 Identity:67/228 - (29%)
Similarity:114/228 - (50%) Gaps:15/228 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIR 183
            ||.|::....|...:.||.||....|::|.|..:.:|||.|||..|.  .||....:  :..|..
Zfish    48 PWQVSIHYIPTGGLLCGGTLINREWVLSAAQCFQKLTASNLVVHLGH--LSTGDPNV--IHNPAS 108

  Fly   184 SIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIF-TGWGKNSFDDPSY 247
            .|:.||.::.....|::||:.|...::.:.:|.|:|:.::..:.......: ||||..:.....:
Zfish   109 QIINHPKYDSATNKNDIALLKLSTPVSFTDYIKPVCLTASGSSLGKGAVSWITGWGSINTGGTQF 173

  Fly   248 MNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG-GEPGKDSCEGDGGSPLACAIKDNPQ 311
            ...|:::.:|||....|:..    ||:  .:.:.::||| .|.||..|.||||.||   :.::.:
Zfish   174 PTTLQEVKIPVVSNGDCKSA----YGS--LITDGMICAGPNEGGKGICMGDGGGPL---VHNSSE 229

  Fly   312 RYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            ::..:||.:||..|..|..|.|:|.|:....||
Zfish   230 QWIQSGIASFGRGCAQPKNPGVFTRVSEYESWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 65/226 (29%)
Tryp_SPc 113..344 CDD:238113 65/226 (29%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 65/226 (29%)
Tryp_SPc 36..265 CDD:238113 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.