DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and TPSB2

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:243 Identity:69/243 - (28%)
Similarity:118/243 - (48%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVAL-LDARTSSYVAGGALIAPHVVITARQ----RTENMTASQLVVRAGEWDFSTKT 172
            |..::.||.|:| :..|...:..||:||.|..|:||..    ..:::.|.::.:|.....:.   
Human    37 APRSKWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQ--- 98

  Fly   173 EQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSR-CIFTG 236
            :||    :|:..|:.||.|.......::||:.|...:..|.|::.:.:|.|.:.|.... |..||
Human    99 DQL----LPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTG 159

  Fly   237 WGKNSFDD---PSYMNVLKKISLPVVQRRTCEQQLRL--YYGNDFELDNSLMCAGGEPGKDSCEG 296
            ||....|:   |.:  .||::.:|:::...|:.:..|  |.|:|..:....|...|...:|||:|
Human   160 WGDVDNDERLPPPF--PLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQG 222

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |.|.||.|.:...   :..||:|::|..|..|..|.:||.|...::||
Human   223 DSGGPLVCKVNGT---WLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 67/241 (28%)
Tryp_SPc 113..344 CDD:238113 67/241 (28%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 69/243 (28%)
Tryp_SPc 31..267 CDD:214473 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.