DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG9737

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:398 Identity:106/398 - (26%)
Similarity:166/398 - (41%) Gaps:93/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AELNQSCGASNEHQ---CVPRHMCKVKIEFRMAMTYRNL-----------------------GCV 65
            ||:.|.|...||.:   |:....||..::.|.|   .||                       |..
  Fly    22 AEVLQECDIPNETKRGVCLEVSRCKAYLQVRNA---TNLPAEKVNFLKKVQCEVEQQVSEAQGSY 83

  Fly    66 STAICCPKN-----------------------LIIKEPRLIINEPITDPQCGF--VNSKGVTFSF 105
            .:.:|||.|                       ...|..:|.......:|..||  :|..|...:.
  Fly    84 ESLVCCPANGQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECGKQVTN 148

  Fly   106 REEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQ--RTENMTASQLV--VRAGEW 166
            |.....:|:..|.||: |||...::.|...||||....::||..  :.|.:...|.:  ||.|| 
  Fly   149 RIYGGEIAELDEFPWL-ALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLGE- 211

  Fly   167 DFSTKTE----QLP--------SVDVPIRSIVRHPGFNLENG--ANNVALVFLRRSLTSSRHINP 217
             |:.|||    :.|        ::|:....|..||.:...:.  .|::|::.|:..::.:..:.|
  Fly   212 -FNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMP 275

  Fly   218 ICMPSAPKNFD------FSRCIFTGWGKNSFDDPSYMNV---LK-KISLPVVQRRTCEQQLRLYY 272
            ||:|:..:...      ||   .:|||:....:..::|:   :| |:.:|.|....|.:.|.   
  Fly   276 ICLPNKSEPLTLAEGQMFS---VSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILE--- 334

  Fly   273 GNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFG-VDCGLPGVPAVYTN 336
            |....|....:|||||..||:|.||.|.||....:.: .|:...|:|::| ..||:.|.||||||
  Fly   335 GFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQH-SRWVAYGVVSYGFTQCGMAGKPAVYTN 398

  Fly   337 VANVIEWI 344
            ||...:||
  Fly   399 VAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 78/259 (30%)
Tryp_SPc 113..344 CDD:238113 78/259 (30%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 11/63 (17%)
Tryp_SPc 149..406 CDD:214473 79/266 (30%)
Tryp_SPc 150..409 CDD:238113 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.