DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG11668

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:421 Identity:101/421 - (23%)
Similarity:156/421 - (37%) Gaps:115/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YGIIAIVSLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHM-------CKVKIEFRMAMTYRNL 62
            :|...|:..:|::  ..|..|||..|         ...|.::       |:......:....|.:
  Fly     6 FGYRLILEFVLIS--TLAYAQNAPWN---------AVAPSYLSIDIYGNCQAHDRPLIGKCVRYV 59

  Fly    63 GCVST-------------------AICCPK-NLIIKEPRLIINEPI------------------T 89
            .|:|.                   .:|||. ..::..|.:..:|..                  |
  Fly    60 DCISAMQAVPRVTPLLCPSSWPNQLVCCPHGGYLLPPPSISKSEQACANAYPRAHHKRRRRRRNT 124

  Fly    90 DPQCGFV-----------NSKGVTFSFREEDTGLAQEAEVPWMVAL-LDARTSSYV--------- 133
            :|:...|           .|:.:....|     |.||.|.|:|.|| ..:||:.::         
  Fly   125 NPKLDQVELVEPIIQKHNQSQNLLVGGR-----LTQENEHPYMCALGWPSRTNRWIHEHGSSKRR 184

  Fly   134 ----AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLE 194
                .|.|:|||...|||.........|..|...|..:.::...||    :.|:.|.:||.|:.|
  Fly   185 YTFNCGCAMIAPRFAITAAHCASVGGESPSVALIGGVELNSGRGQL----IEIKRISQHPHFDAE 245

  Fly   195 NGANNVALVFL-RRSLTSSRHINPIC------MPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLK 252
            ...|::|:|.| |||     |:...|      :|..|       ....|:|:..|..|...|:| 
  Fly   246 TLTNDLAVVKLARRS-----HMPVACLWNQESLPERP-------LTALGYGQTKFAGPHSSNLL- 297

  Fly   253 KISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK-DSCEGDGGSPLACAIKDNPQRYEL- 315
            :|.|..:..:.|::.|..|......|.:..||||...|. |:|:||.|.||.........|:.: 
  Fly   298 QIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHHRHTIP 362

  Fly   316 --AGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
              .||.:||..|. .|.|.||..:|:.|:||
  Fly   363 YVVGITSFGGACA-SGQPGVYVRIAHYIQWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 75/255 (29%)
Tryp_SPc 113..344 CDD:238113 75/255 (29%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 79/267 (30%)
Tryp_SPc 149..392 CDD:214473 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.