DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG10041

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:231 Identity:50/231 - (21%)
Similarity:95/231 - (41%) Gaps:24/231 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSY--VAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVP 181
            |::|::.:.....|  :..|.:::...|::|....:.....||.| ||..|.....:|.....|.
  Fly    51 PYIVSIGENLKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQLYV-AGGADSLNSRKQTRFFVVE 114

  Fly   182 IRSIVRHPGFNLENGANNVAL--VFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDD 244
            .|   .||.|.: .|.|::|:  ::.:..|...| ...|.....|:....::....|||:...  
  Fly   115 RR---WHPQFRV-LGGNDIAVLRIYPKFPLDDVR-FRSINFAGKPQRDSGTQASLVGWGRVGV-- 172

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKD 308
             ..:..|:::....::...|:|..|..:....::     ||....| :..|:||.|:||.     
  Fly   173 -GKIRKLQEMPFLTMENDECQQSHRFVFLKPLDI-----CAMHLKGPRGPCDGDSGAPLM----- 226

  Fly   309 NPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |..:.:|.|::::|.....|..|..:|.:.....||
  Fly   227 NVAKEKLYGLLSYGRKACTPLKPYAFTRINAYSSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 48/229 (21%)
Tryp_SPc 113..344 CDD:238113 48/229 (21%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 50/231 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.