DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and flz

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:288 Identity:90/288 - (31%)
Similarity:129/288 - (44%) Gaps:43/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PRLIINEPITDPQCG---------FVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYV-- 133
            |.|..:.|.|  :||         .|..||.||            ...||.|.:   |.|:::  
  Fly  1427 PNLAFHSPST--ECGVRPHVKSGRIVGGKGSTF------------GAYPWQVLV---RESTWLGL 1474

  Fly   134 -----AGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNL 193
                 .||.||....||||........|| ||...||:|.|...|...||...::.::.|..::.
  Fly  1475 FTKNKCGGVLITSRYVITAAHCQPGFLAS-LVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDP 1538

  Fly   194 ENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDD--PSYMNVLKKISL 256
            ....|::||:.|...:....||.|||||:...:|.......||||:..:..  ||   ||:::.:
  Fly  1539 ATFENDLALLELDSPVQFDTHIVPICMPNDVADFTGRMATVTGWGRLKYGGGVPS---VLQEVQV 1600

  Fly   257 PVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPG-KDSCEGDGGSPLACAIKDNPQRYELAGIVN 320
            |:::...|::.... .|::.::..|.:|||...| |||||||.|.||.....|.  ||||||.|:
  Fly  1601 PIIENSVCQEMFHT-AGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDG--RYELAGTVS 1662

  Fly   321 FGVDCGLPGVPAVYTNVANVIEWITLTT 348
            .|:.|..|.:|.||........|:...|
  Fly  1663 HGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 77/240 (32%)
Tryp_SPc 113..344 CDD:238113 77/240 (32%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 83/261 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.