DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG30371

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_610370.1 Gene:CG30371 / 35806 FlyBaseID:FBgn0050371 Length:399 Species:Drosophila melanogaster


Alignment Length:244 Identity:68/244 - (27%)
Similarity:109/244 - (44%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 EVPWMVALLD-ARTSSYVAGGALIAPHVVITARQRTENMT-ASQLVVRAGEWDF----STKTEQL 175
            |.|.|.||.| .:..:...||.::|...::||......:: |:.:|...|..|.    |::..|.
  Fly   160 EFPSMAALKDVTKNQASFCGGTIVAHRYILTAAHCIYQVSRATNIVAIVGTNDLGNPSSSRYYQQ 224

  Fly   176 PSVD--VPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMP----SAPKNFDFSRCIF 234
            .::.  :|....|..|..|     |::|::....::..||.:.|||:|    |.|..:|....| 
  Fly   225 YNIQQMIPHEQYVSDPDVN-----NDIAVLITASNIQWSRGVGPICLPPVGTSTPFTYDLVDVI- 283

  Fly   235 TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCA---GGEPGKDSCEG 296
             |:|...|..|:..: |:||:|.||..:.|:.:    |.|...:....||.   .| .|:|||:.
  Fly   284 -GYGTVFFAGPTSTS-LQKINLNVVTNQDCQTE----YNNVATIYTGQMCTYDYSG-TGRDSCQF 341

  Fly   297 DGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVP-AVYTNVANVIEWI 344
            |.|.|:..    ...|..|.||:::|..|.....| .|.|.:.:.|.||
  Fly   342 DSGGPVIL----RKSRQFLVGIISYGKSCAESQYPMGVNTRITSYISWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 66/242 (27%)
Tryp_SPc 113..344 CDD:238113 66/242 (27%)
CG30371NP_610370.1 CUB 24..>67 CDD:294042
Tryp_SPc 149..386 CDD:214473 66/242 (27%)
Tryp_SPc 150..389 CDD:238113 68/244 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.