DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG18563

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:405 Identity:120/405 - (29%)
Similarity:178/405 - (43%) Gaps:98/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MYGIIAIVSLILVAGQVQAQGQNAELNQSCGASNE--HQCVPRHMCKVKIEFRMAMTYRNLGCVS 66
            |..|:|..:::|.                |..|.|  ..|||...|       :.::.:...|..
  Fly     1 MGSIVATAAILLF----------------CVLSGEACRYCVPMEKC-------LILSRKLNSCPF 42

  Fly    67 TAICCPKNLIIKEPRLIINEPITDPQCGFVNSKGVTFSFREED------------------TGLA 113
            ..:||  ::|||.| .|.:.|..:.     :|:..:.|..||:                  ..::
  Fly    43 NHVCC--DIIIKSP-YIPSGPNEES-----DSESASSSTEEENIPTFIYFPTRPTVSSEPQNNVS 99

  Fly   114 QEAEVP-----------------------------------------WMVALLDARTSSYVAGGA 137
            .|.:||                                         |:|||.....  |:.||:
  Fly   100 TEPDVPITYWPLKGSGAPTNDGAQAEQPKPTERTQPGGRCNTTGLYSWVVALFYEEV--YLTGGS 162

  Fly   138 LIAPHVVITARQRTEN-MTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVA 201
            ||:|.|::||...|.| |...::||||||:..:|..|.:...:..:..||||.||..::|.||||
  Fly   163 LISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYEERVVERIVRHEGFIFQSGINNVA 227

  Fly   202 LVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQ 266
            |:|::.....:..|..:.:||...:|:..||...||...|..|.|.|.::||:.|.|:.|.||..
  Fly   228 LIFVKTPFVLNDRIGVLTLPSRQASFEGRRCTVAGWDLVSSHDQSRMRIIKKLELTVLDRTTCVA 292

  Fly   267 QLR-LYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKD-NPQRYELAGIVNFGVDCGLPG 329
            |.| ...|.:|:|..||:||..|..:|.|.|.||..|.|::.| ||..:|.||||.:|:.||| .
  Fly   293 QFRNTTLGRNFDLHPSLICARSEINRDFCFGGGGYALFCSLGDENPHVFEQAGIVAWGMGCGL-D 356

  Fly   330 VPAVYTNVANVIEWI 344
            :|.:|||||....||
  Fly   357 LPGIYTNVAMFRSWI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 94/274 (34%)
Tryp_SPc 113..344 CDD:238113 94/274 (34%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 93/228 (41%)
Tryp_SPc 147..371 CDD:214473 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.