DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG3355

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:116/238 - (48%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDAR-TSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPI 182
            ||...|:..| ......||:||....|:||...... ...|:.:|..:.|.|::.   |.:   :
  Fly    88 PWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHG-NRDQITIRLLQIDRSSRD---PGI---V 145

  Fly   183 RSIVR---HPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDD 244
            |.:|:   ||.::.....|:|||:.|...:..:.::.|:|:|.|..|||....:..|||... :.
  Fly   146 RKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIK-EG 209

  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLACAIK 307
            ....|.|:::::||:....|.|   ..|.:  ::...::|||  .:.|||:|:||.|.||..   
  Fly   210 GVTSNYLQEVNVPVITNAQCRQ---TRYKD--KIAEVMLCAGLVQQGGKDACQGDSGGPLIV--- 266

  Fly   308 DNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVN 350
             |..||:|||:|:||..|.....|.||..|:..::||...|.:
  Fly   267 -NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTAD 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 68/230 (30%)
Tryp_SPc 113..344 CDD:238113 68/230 (30%)
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 68/230 (30%)
Tryp_SPc 76..305 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.