DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG3117

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:364 Identity:125/364 - (34%)
Similarity:186/364 - (51%) Gaps:45/364 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIE-FRMAMTYRNLGCVSTAICCPKNL 75
            ||:::.|.:.:.|.    ...|.:||  .||||..|:.::. |..:.|   :.|....:||.|:.
  Fly     7 SLVIILGLILSSGG----THICLSSN--LCVPRENCREEMPFFDFSST---IECSDEEVCCEKSN 62

  Fly    76 II---KEPRLIINEPITDPQ--------CGFVNS-KGVTFSFREEDTGLAQEAEVPWMVALLDAR 128
            :|   |.|          ||        ..:.|: .|....|.::    .:..:.||:.||.  .
  Fly    63 VIGMSKSP----------PQHSVDTLLRTSYPNALDGSPQVFGDQ----TKPNQFPWVTALF--A 111

  Fly   129 TSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNL 193
            ..||:.||:||.|.:|:||......::.:.::|||||||.|:..:..|.:|..:..|:.|..||.
  Fly   112 KGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLSSSEKLNPPMDRQVIKIMEHEAFNY 176

  Fly   194 ENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPV 258
            .:|||::||:||........:|..|.:|...|.||...|...|||..|..|.....:.:|:.|||
  Fly   177 SSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRSSTDVDIQTIQQKVDLPV 241

  Fly   259 VQRRTCEQQLRL-YYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFG 322
            |:...|::|||| ..|::::|..||||||||.|:|.|...||..|.|::.|:|.|||.||||:||
  Fly   242 VESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVCSLFGGFALFCSLDDDPNRYEQAGIVSFG 306

  Fly   323 VDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEEREEVP 361
            |.||...||..:|:|:..:|||.      |..|:...||
  Fly   307 VGCGQANVPTTFTHVSKFMEWIN------PHLEQVLSVP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 93/231 (40%)
Tryp_SPc 113..344 CDD:238113 93/231 (40%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 94/239 (39%)
Tryp_SPc 95..328 CDD:214473 93/238 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.