DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG1304

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:249 Identity:74/249 - (29%)
Similarity:110/249 - (44%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITARQRTEN---------MTASQLVVRAGEWD- 167
            |.:.:.|..|:|.:|  .|:..||::::.:.|:||.....|         :.|.:..:|||..| 
  Fly    38 AVKNQFPHQVSLRNA--GSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDR 100

  Fly   168 FSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSA--PKNFDFS 230
            ||      ..|.|.:..::.|..:.  |..|:|||:.|...|..|..|.||.:|:|  |.:.|  
  Fly   101 FS------GGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTADTPADVD-- 155

  Fly   231 RCIFTGWG--KNSFDDPSYM--NVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGK 291
             .|.:|||  |:..|.|.|:  |.||.|||     ..|::.:.  :|...||     |...|...
  Fly   156 -VIISGWGRIKHQGDLPRYLQYNTLKSISL-----ERCDELIG--WGVQSEL-----CLIHEADN 207

  Fly   292 DSCEGDGGSPLACAIKDNPQRYELAGIVNF-GVDCGLPGVPAVYTNVANVIEWI 344
            .:|.||.|.|   |:.:|    ::.|:..| ...|| ...|..|..|....|||
  Fly   208 GACNGDSGGP---AVYNN----QVVGVAGFVWSACG-TSYPDGYARVYYHNEWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 72/247 (29%)
Tryp_SPc 113..344 CDD:238113 72/247 (29%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/247 (29%)
Tryp_SPc 32..256 CDD:238113 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.