DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG9676

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:242 Identity:68/242 - (28%)
Similarity:110/242 - (45%) Gaps:40/242 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVALLDARTSSYVAGGALIAPHVVITA----RQRTENMTASQLVVRAGEWDFSTKTE 173
            |:|.:.|..::|  .|..|:..||::|:...|:||    :|......|::|.::||....|:   
  Fly    34 AREGQFPHQISL--RRRGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGSLLLSS--- 93

  Fly   174 QLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICM----PSAPKNFDFSRCIF 234
              ..|.||:.::..||.:| .|| ::||::.||.|||.:.:|..|.:    |......|.|    
  Fly    94 --GGVRVPVATVTVHPNYN-SNG-HDVAVLRLRNSLTFNSNIAAIKLATEDPPNDATVDIS---- 150

  Fly   235 TGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQ-QLRLYYGNDFELDNSLMCAGGEPGKDSCEGDG 298
             |||..|...| ..|.|..:.:..:.|.:|:: .||       :|..:.||......|.:|.||.
  Fly   151 -GWGAISQRGP-ISNSLLYVQVKALSRESCQKTYLR-------QLPETTMCLLHPKDKGACYGDS 206

  Fly   299 GSPLACAIKDNPQRYELAGIVNFGV-DCGLPGVPAVYTNVANVIEWI 344
            |.|..       .:.:|.|:.:|.: .|| ...|..|..|:.:..||
  Fly   207 GGPAT-------YQGKLVGLASFVIGGCG-RAAPDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 66/240 (28%)
Tryp_SPc 113..344 CDD:238113 66/240 (28%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 66/240 (28%)
Tryp_SPc 28..248 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.