DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and gd

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_001259479.1 Gene:gd / 32159 FlyBaseID:FBgn0000808 Length:531 Species:Drosophila melanogaster


Alignment Length:382 Identity:80/382 - (20%)
Similarity:141/382 - (36%) Gaps:117/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PRHMC---KVKIEFRMAMTYRNLGCVSTAICCPKNLIIKEPRLIINEPITDPQCGFVNSKG---V 101
            |:.:|   ...::|.::....:|           ::.|.||:  .::.||.|.  ||:...   :
  Fly   184 PKEICGRIDRDLDFHLSQRTESL-----------HVAIGEPK--SSDGITSPV--FVDDDEDDVL 233

  Fly   102 TFSFREEDTGLAQEAEV------------PWMVALLDARTSS--YVAGGALIAPHVVITA----R 148
            ...|.:|....|.|::.            ||:.|:.....:|  :..||:|::..|||::    :
  Fly   234 EHQFVDESEAEAIESDSADSLPSITRGSWPWLAAIYVNNLTSLDFQCGGSLVSARVVISSAHCFK 298

  Fly   149 QRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFN--LENGANNVALVFLRRSLTS 211
            ...:..|:::::|..|..:.....|: .|:..|:..|..||.||  |.:...::|::.|:..:..
  Fly   299 LFNKRYTSNEVLVFLGRHNLKNWNEE-GSLAAPVDGIYIHPDFNSQLSSYDADIAVIILKDEVRF 362

  Fly   212 SRHINPICMPSAPKNFDF---SRCIFTGW------------------GKNSFDDPSYMNVLKKIS 255
            :..|.|.|:.|.....::   .|.|..||                  ||.|.|    .:..|.:.
  Fly   363 NTFIRPACLWSGSSKTEYIVGERGIVIGWSFDRTNRTRDQKLSSELPGKKSTD----ASAPKVVK 423

  Fly   256 LPVVQRRTCEQQLRLYYGNDFELD--------NSLMCAG--------GEPGKDSCEGDGGSPLAC 304
            .|:|....|           |..:        |...|||        .:.|.....|..|:.|  
  Fly   424 APIVGNAEC-----------FRANAHFRSLSSNRTFCAGIQAEERDTHQSGASIYTGISGAGL-- 475

  Fly   305 AIKDNPQRYELAGIVNFGVDCGLPGVPA----------------VYTNVANVIEWIT 345
            .|:.| .|:.|.|.|:    ..||.|..                :|.:||..::|||
  Fly   476 FIRRN-NRWMLRGTVS----AALPAVETPDAESSHKLCCKNQYIIYADVAKFLDWIT 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 63/303 (21%)
Tryp_SPc 113..344 CDD:238113 63/303 (21%)
gdNP_001259479.1 GD_N 27..124 CDD:292649
Tryp_SPc 257..526 CDD:238113 61/291 (21%)
Tryp_SPc 258..526 CDD:214473 61/290 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.