DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and Tpsg1

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:122/284 - (42%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PQCGF-------------VNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYVAGGALIAPH 142
            |.|||             |:..|    .|......||....||..:|...:.  :|.||:|::|.
  Rat     5 PYCGFLLLLAVPGCGQPQVSHAG----SRIVGGHAAQAGAWPWQASLRLQKV--HVCGGSLLSPE 63

  Fly   143 VVITARQ-RTENMTASQLVVRAGEW------DFSTKTEQLPSVDVPIRSIVRH------PGFNLE 194
            .|:||.. .:.::.:|...|..||.      .|||           ::.|:.:      ||    
  Rat    64 WVLTAAHCFSGSVNSSDYEVHLGELTITLSPHFST-----------VKQIIMYSSAPGPPG---- 113

  Fly   195 NGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWGKNSFDD---PSYMNVLKKIS 255
             .:.::|||.|...:..|..:.|:|:|.|..:| ...:|..||||.....:   |.|.  |::..
  Rat   114 -SSGDIALVQLATPVALSSQVQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYN--LQEAK 175

  Fly   256 LPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVN 320
            :.||...||.|......|:..:.|  ::||.| || |:|:.|.|.||.|.:..   .::.||:|:
  Rat   176 VSVVDVETCSQAYSSSNGSLIQSD--MLCAWG-PG-DACQDDSGGPLVCRVAG---IWQQAGVVS 233

  Fly   321 FGVDCGLPGVPAVYTNVANVIEWI 344
            :|..||.|..|.||..|...:.||
  Rat   234 WGEGCGRPDRPGVYARVTAYVNWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 71/247 (29%)
Tryp_SPc 113..344 CDD:238113 71/247 (29%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 72/254 (28%)
Tryp_SPc 30..260 CDD:238113 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.