DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and Tpsb2

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:246 Identity:75/246 - (30%)
Similarity:124/246 - (50%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AQEAEVPWMVAL-LDARTSSYVAGGALIAPHVVITARQ------RTENMTASQLVVRAGEWDFST 170
            |.|::.||.|:| .......:..||:||.|..|:||..      ::..:...||     ...:..
  Rat    36 ASESKWPWQVSLRFKFSFWMHFCGGSLIHPQWVLTAAHCVGLHIKSPELFRVQL-----REQYLY 95

  Fly   171 KTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIF 234
            ..:||.:|:   |::|....:.:|:|| ::||:.|...:..|.||:|..:|.|.:.| ..:.|..
  Rat    96 YADQLLTVN---RTVVHPHYYTVEDGA-DIALLELENPVNVSTHIHPTSLPPASETFPSGTSCWV 156

  Fly   235 TGWGKNSFDD---PSYMNVLKKISLPVVQRRTCEQQLR--LYYGNDFEL-DNSLMCAGGEPGKDS 293
            ||||....|:   |.|  .||::.:|:|:...|:::..  ||.|:|..: .:.::|| |....||
  Rat   157 TGWGDIDSDEPLLPPY--PLKQVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCA-GNTRSDS 218

  Fly   294 CEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWI 344
            |:||.|.||.|.:|..   :..||:|::|..|.....|.:||.|...::||
  Rat   219 CQGDSGGPLVCKVKGT---WLQAGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 73/244 (30%)
Tryp_SPc 113..344 CDD:238113 73/244 (30%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 75/246 (30%)
Tryp_SPc 30..266 CDD:214473 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.