DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and Tpsg1

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:267 Identity:78/267 - (29%)
Similarity:127/267 - (47%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PWMVALLDARTSSYVAGGALIAPHVVITARQ-RTENMTASQLVVRAGEW------DFSTKTEQLP 176
            ||..:|...:.  :|.||:|::|..|:||.. .:.::.:|...|..||.      .|||      
Mouse    99 PWQASLRLHKV--HVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTVTLSPHFST------ 155

  Fly   177 SVDVPIRSIVRHPGFNLENGAN-NVALVFLRRSLTSSRHINPICMPSAPKNF-DFSRCIFTGWGK 239
                 ::.|:.:.|.....|:: ::|||.|...:..|..:.|:|:|.|..:| ...:|..||||.
Mouse   156 -----VKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWGY 215

  Fly   240 NSFDD---PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSP 301
            ....:   |.|.  |::..:.||..:||.|......|:..:.|  ::||.| || |:|:.|.|.|
Mouse   216 TGEGEPLKPPYN--LQEAKVSVVDVKTCSQAYNSPNGSLIQPD--MLCARG-PG-DACQDDSGGP 274

  Fly   302 LACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVNMPLPEE----REEVPY 362
            |.|.:...   ::.||:|::|..||.|..|.||..|...:.||     :..:||.    .:.:|:
Mouse   275 LVCQVAGT---WQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI-----HHHIPEAGGSGMQGLPW 331

  Fly   363 ASPTLSA 369
            | |.|:|
Mouse   332 A-PLLAA 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 69/236 (29%)
Tryp_SPc 113..344 CDD:238113 69/236 (29%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.