DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18477 and CG30375

DIOPT Version :9

Sequence 1:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster
Sequence 2:NP_724665.1 Gene:CG30375 / 246575 FlyBaseID:FBgn0050375 Length:398 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:128/262 - (48%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGFVNSKGVTFSFREEDTGLAQEAEVPWMVALLDARTSSYV-AGGALIAPHVVITARQRTENM-T 155
            ||:      :|..|..:...|.:.|.|.||.|.|..::..: .||::::...::||...|... .
  Fly   144 CGW------SFPNRIANGVEAGKHEFPSMVGLRDLSSNLPIFCGGSIVSERYIMTAAHCTARQPV 202

  Fly   156 ASQLVVRAGEWDFSTKTEQLPSVDVPIRSIVRHPGFNLENGANNVALVFLRRSLTS---SRHINP 217
            ||:|:...||.|.||..|.:.:....|::|:.|||: :|..:.|:..:.|.::.|.   ||.:.|
  Fly   203 ASRLLALVGEHDLSTGAESIYAAQYRIQNIINHPGY-METASGNINDIALLQTATPIEWSRGVAP 266

  Fly   218 ICMP--SAPKNFDFSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDN 280
            ||:|  .|..:|::......|||...| ..|..|.|:|.:|..:....|..:.      :..:..
  Fly   267 ICLPIRQAENSFNYQNVDIMGWGTLGF-AASKSNTLQKATLLTMDNAVCRSRF------NSSITP 324

  Fly   281 SLMC---AGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIE 342
            |.:|   |||. |:|||:.|.|.|:  .::...:.::| |::::|..||.|....|.|.|.:.:.
  Fly   325 SHLCTYDAGGR-GQDSCQYDSGGPV--ILRQRERMFQL-GVISYGRACGQPFGIGVNTRVTSHLN 385

  Fly   343 WI 344
            |:
  Fly   386 WL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 69/240 (29%)
Tryp_SPc 113..344 CDD:238113 69/240 (29%)
CG30375NP_724665.1 CUB 38..>100 CDD:294042
Tryp_SPc 151..386 CDD:214473 70/246 (28%)
Tryp_SPc 152..387 CDD:238113 69/246 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.